PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015884775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 692aa    MW: 76217.7 Da    PI: 6.3141
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015884775.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28204257155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  XP_015884775.1 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                     79*******************.********************************8 PP

2Response_reg76.87.7e-26201281109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ +++l+++l++ +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++g+ +++ + +  G
  XP_015884775.1  20 VLAVDDDPTCLKVLETLLRRCQY-HVTTTSQAIMALKMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSGNGDTKLVMKGITHG 112
                     799********************.***************888888*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_015884775.1 113 ACDYLLKPVRIEELKN 128
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.2E-1691689IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.5E-4217141No hitNo description
SuperFamilySSF521721.42E-3517138IPR011006CheY-like superfamily
SMARTSM004481.3E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.47119134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.3E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.47E-2721134No hitNo description
PROSITE profilePS5129412.269201260IPR017930Myb domain
SuperFamilySSF466898.06E-20201261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-30202262IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-25204257IPR006447Myb domain, plants
PfamPF002491.2E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MTVETTVDDR RSQFPVGMRV LAVDDDPTCL KVLETLLRRC QYHVTTTSQA IMALKMLREN  60
KNKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSGNG DTKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVIRRKKFD SKDCKNSGNQ DKSHIGNGEG GPESAETGNS DQNGKLNKKR  180
KDQDEDEDED RDENDNDDPS TQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGSSD SSYLRMSSMN GLGSYTALSG  300
SVQFQSPAFR SFPPSGMIGR LNTPAGMGLH CLPSSGRLQL GHPQNLSNST DQVKFHPATV  360
LGKHNGNMLQ RMPVSFELDQ QNSKGVTHIG EFSTAIDDTP IFPLSNGLPD AKITGNSSNS  420
ALAVSTSSMM LGNLQDDQCG RKFGGQSSVS MTSLKSEFCS PLPDHGRCTE NWSSSAQLSG  480
YQSNSLLSGD RFKQASTHPS SLRDNLSVMA SQMGSNRFDV SSVTSASTQF QDLRTDIQGQ  540
QSAISSNAGQ TINEALIHGW DNQKPDSTYP SNIMCSSMNS LMPVNDAMGP LEQSLDSKNS  600
IFDRSMDFNL IGQSNYVDPL IMKHDEVEKP TMETSLRSKQ GYLLDQKRPQ GSYISNTVGS  660
LEDLVSAMMK QEQDKAKSME GEFDAYSLGP SM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-26200263164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884775.10.0PREDICTED: two-component response regulator ARR12
SwissprotB8AEH11e-146ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLW9QUF00.0W9QUF0_9R
STRINGVIT_04s0008g05900.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-134response regulator 12